PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000438t1
Common NameTCM_000438
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 210aa    MW: 24129.2 Da    PI: 6.6369
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000438t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.5e-2055109357
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       k++++++eq++ Le  F  ++++  e++ +LA+ lgL+ rqV vWFqNrRa++k+
  Thecc1EG000438t1  55 KKRKLSQEQVNLLEHNFSDEHKLESERKDRLASDLGLDPRQVAVWFQNRRARWKN 109
                       45699************************************************95 PP

2HD-ZIP_I/II118.34.2e-3855145292
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       kkr+ls+eqv+lLE++F+ e+kLe+erK +la++Lgl+prqvavWFqnrRAR+k+k+lE++y++Lk+ ++  + ++++Le+ev +L+ +l 
  Thecc1EG000438t1  55 KKRKLSQEQVNLLEHNFSDEHKLESERKDRLASDLGLDPRQVAVWFQNRRARWKNKKLEEEYNKLKTVHEGAVLDKCHLESEVLKLKGQLC 145
                       9**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.64950110IPR001356Homeobox domain
SMARTSM003894.2E-1853114IPR001356Homeobox domain
SuperFamilySSF466895.01E-1854118IPR009057Homeodomain-like
CDDcd000861.87E-1655111No hitNo description
PfamPF000466.5E-1755109IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-2057117IPR009057Homeodomain-like
PRINTSPR000312.4E-58190IPR000047Helix-turn-helix motif
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PRINTSPR000312.4E-590106IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MTSSIQMNEL EDHMALISQM YPGVYTQIAP HQGESKPRRR RKKNKGGENS LAGAKKRKLS  60
QEQVNLLEHN FSDEHKLESE RKDRLASDLG LDPRQVAVWF QNRRARWKNK KLEEEYNKLK  120
TVHEGAVLDK CHLESEVLKL KGQLCEAEKE IQRLAERVDG VSSNSPSSSL SMEAMDPPFL  180
GEFGVEGYDD VFYMPENSYI HGMEYWMNL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13856RRRKKNKGGENSLAGAKKR
24057RKKNKGGENSLAGAKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047003.11e-156Homeobox protein, putative
SwissprotO232081e-77ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLA0A061DFY21e-156A0A061DFY2_THECC; Homeobox protein, putative
STRINGPOPTR_0005s12760.16e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22082677
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-60homeobox protein 40
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]